uu.seUppsala University Publications
Change search
Link to record
Permanent link

Direct link
BETA
Publications (10 of 15) Show all publications
Nordström, R., Andrén, O. C. .., Singh, S., Malkoch, M., Davoudi, M., Schmidtchen, A. & Malmsten, M. (2019). Degradable dendritic nanogels as carriers for antimicrobial peptides. Journal of Colloid and Interface Science, 554, 592-602
Open this publication in new window or tab >>Degradable dendritic nanogels as carriers for antimicrobial peptides
Show others...
2019 (English)In: Journal of Colloid and Interface Science, ISSN 0021-9797, E-ISSN 1095-7103, Vol. 554, p. 592-602Article in journal (Refereed) Published
Abstract [en]

In the present study, we investigate degradable anionic dendritic nanogels (DNG) as carriers for antimicrobial peptides (AMPs). In such systems, the dendritic part contains carboxylic acid-based anionic binding sites for cationic AMPs, whereas linear poly(ethylene glycol) (PEG) chains form a shell for promotion of biological stealth. In order to clarify factors influencing membrane interactions of such systems, we here address effects of nanogel charge, cross-linking, and degradation on peptide loading/release, as well as consequences of these factors for lipid membrane interactions and antimicrobial effects. The DNGs were found to bind the AMPs LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW). For the smaller DPK-060 peptide, loading was found to increase with increasing nanogel charge density. For the larger LL-37, on the other hand, peptide loading was largely insensitive to nanogel charge density. In line with this, results on the secondary structure, as well as on the absence of stabilization from proteolytic degradation by the nanogels, show that the larger LL-37 is unable to enter into the interior of the nanogels. While 40–60% nanogel degradation occurred over 10 days, promoted at high ionic strength and lower cross-linking density/higher anionic charge content, peptide release at physiological ionic strength was substantially faster, and membrane destabilization not relying on nanogel degradation. Ellipsometry and liposome leakage experiments showed both free peptide and peptide/DNG complexes to cause membrane destabilization, indicated also by antimicrobial activities being comparable for nanogel-bound and free peptide. Finally, the DNGs were demonstrated to display low toxicity towards erythrocytes even at peptide concentrations of 100 µM.

Keywords
Antimicrobial peptide, Degradable, Dendritic, Hyperbranched, drug delivery, Membrane, Nanogel
National Category
Pharmaceutical Sciences Physical Chemistry
Research subject
Pharmaceutical Physical Chemistry
Identifiers
urn:nbn:se:uu:diva-389746 (URN)10.1016/j.jcis.2019.07.028 (DOI)000487346200061 ()31330426 (PubMedID)
Funder
Swedish Research Council, 2016-05157Swedish Research Council, 2017-02341EU, FP7, Seventh Framework Programme, 604182
Available from: 2019-07-23 Created: 2019-07-23 Last updated: 2019-11-01Bibliographically approved
Parra-Ortiz, E., Browning, K. L., Damgaard, L. S. E., Nordström, R., Micciulla, S., Bucciarelli, S. & Malmsten, M. (2019). Effects of oxidation on the physicochemical properties of polyunsaturated lipid membranes. Journal of Colloid and Interface Science, 538, 404-419
Open this publication in new window or tab >>Effects of oxidation on the physicochemical properties of polyunsaturated lipid membranes
Show others...
2019 (English)In: Journal of Colloid and Interface Science, ISSN 0021-9797, E-ISSN 1095-7103, Vol. 538, p. 404-419Article in journal (Refereed) Published
Abstract [en]

The exposure of biological membranes to reactive oxygen species (ROS) plays an important role in many pathological conditions such as inflammation, infection, or sepsis. ROS also modulate signaling processes and produce markers for damaged tissue. Lipid peroxidation, mainly affecting polyunsaturated phospholipids, results in a complex mixture of oxidized products, which may dramatically alter membrane properties. Here, we have employed a set of biophysical and surface-chemical techniques, including neutron and X-ray scattering, to study the structural, compositional, and stability changes due to oxidative stress on phospholipid bilayers composed of lipids with different degrees of polyunsaturation. In doing so, we obtained real-time information about bilayer degradation under in situ UV exposure using neutron reflectometry. We present a set of interrelated physicochemical effects, including gradual increases in area per molecule, head group and acyl chain hydration, as well as bilayer thinning, lateral phase separation, and defect formation leading to content loss upon membrane oxidation. Such effects were observed to depend on the presence of polyunsaturated phospholipids in the lipid membrane, suggesting that these may also play a role in the complex oxidation processes occurring in cells.

Place, publisher, year, edition, pages
ACADEMIC PRESS INC ELSEVIER SCIENCE, 2019
Keywords
Lipid membrane, Neutron reflectometry, Oxidative stress, Polyunsaturation, X-ray scattering
National Category
Biophysics
Identifiers
urn:nbn:se:uu:diva-378622 (URN)10.1016/j.jcis.2018.12.007 (DOI)000458596500042 ()30530078 (PubMedID)
Funder
Novo Nordisk, NNF150C0016670
Available from: 2019-03-11 Created: 2019-03-11 Last updated: 2019-03-11Bibliographically approved
Nordström, R., Nyström, L., Ilyas, H., Atreya, H. S., Borro, B. C. & Malmsten, M. (2019). Microgels as carriers of antimicrobial peptides – effects of peptide PEGylation. Colloids and Surfaces A: Physicochemical and Engineering Aspects, 565, 8-15
Open this publication in new window or tab >>Microgels as carriers of antimicrobial peptides – effects of peptide PEGylation
Show others...
2019 (English)In: Colloids and Surfaces A: Physicochemical and Engineering Aspects, ISSN 0927-7757, E-ISSN 1873-4359, Vol. 565, p. 8-15Article in journal (Refereed) Published
Abstract [en]

Delivery systems are likely to be central for the translation of antimicrobial peptides (AMPs) towards therapeutics. Addressing AMP interactions with microgel carriers, we here investigate how poly(ethylene glycol) conjugation ('PEGylation') of AMPs affect their loading and release to/from microgels, combining structural studies using nuclear magnetic resonance (NMR) with ellipsometry, circular dichroism spectroscopy (CD), and light scattering. Such studies demonstrate that poly(ethyl acrylate-co-methacrylic acid) microgels bind considerable amounts of the positively charged AMP KYE28 (KYEITTIHNLFRKLTHRLFRRNFGYTLR) and its PEGylated variants KYE28-PEG48, PEG48-KYE28, and PEG24-KYE28-PEG24. Z-potential measurements indicate that KYE28 resides primarily inside the microgel core, and that localization of the PEGylated peptides is shifted towards the microgel corona. Furthermore, while all peptides are disordered in solution, CD measurements report on helix induction on microgel binding, particularly so for the PEGylated peptides. Addressing such conformational changes in more detail, NMR structural studies showed that peptide-microgel interactions are facilitated by a hydrophobic domain formed by the peptide after microgel binding, and with modulating electrostatic/salt bridge interaction between the positively charged peptide residues and negative microgel charges. As the microgels remain negatively charged also at high peptide load, membrane disruption and antimicrobial effects necessitates peptide release, demonstrated to be promoted by PEGylation and high ionic strength. Importantly, microgel loading, as well as peptide localization, conformation, and release, did not depend significantly on PEG conjugation site, but instead seems to be dictated by the PEG content of the peptide conjugates.

Keywords
Antimicrobial peptide, Drug delivery, Microgel, NMR, PEGylation
National Category
Pharmaceutical Sciences
Identifiers
urn:nbn:se:uu:diva-361401 (URN)10.1016/j.colsurfa.2018.12.049 (DOI)000457062300002 ()
Funder
Swedish Research Council, 2012-1842Swedish Research Council, 2015-06720
Available from: 2018-09-24 Created: 2018-09-24 Last updated: 2019-10-12Bibliographically approved
Zhang, Y., Andren, O. C. J., Nordström, R., Fan, Y., Malmsten, M., Mongkhontreerat, S. & Malkoch, M. (2019). Off-Stoichiometric Thiol-Ene Chemistry to Dendritic Nanogel Therapeutics. Advanced Functional Materials, 29(18), Article ID 1806693.
Open this publication in new window or tab >>Off-Stoichiometric Thiol-Ene Chemistry to Dendritic Nanogel Therapeutics
Show others...
2019 (English)In: Advanced Functional Materials, ISSN 1616-301X, E-ISSN 1616-3028, Vol. 29, no 18, article id 1806693Article in journal (Refereed) Published
Abstract [en]

A novel platform of dendritic nanogels is herein presented, capitalizing on the self-assembly of allyl-functional polyesters based on dendritic-linear-dendritic amphiphiles followed by simple cross-linking with complementary monomeric thiols via UV initiated off-stoichiometric thiol-ene chemistry. The facile approach enabled multigram creation of allyl reactive nanogel precursors, in the size range of 190-295 nm, being readily available for further modifications to display a number of core functionalities while maintaining the size distribution and characteristics of the master batch. The nanogels are evaluated as carriers of a spread of chemotherapeutics by customizing the core to accommodate each individual cargo. The resulting nanogels are biocompatible, displaying diffusion controlled release of cargo, maintained therapeutic efficacy, and decreased cargo toxic side effects. Finally, the nanogels are found to successfully deliver pharmaceuticals into a 3D pancreatic spheroids tumor model.

Place, publisher, year, edition, pages
Wiley-VCH Verlagsgesellschaft, 2019
Keywords
cancer treatment, dendritic nanogel, drug delivery, nanomedicine
National Category
Polymer Chemistry
Identifiers
urn:nbn:se:uu:diva-389829 (URN)10.1002/adfm.201806693 (DOI)000471330500004 ()
Funder
Knut and Alice Wallenberg Foundation, 2012-0196EU, FP7, Seventh Framework Programme, 60418Swedish Childhood Cancer Foundation, TJ2017-0009Swedish Research Council, 2010-453
Available from: 2019-07-29 Created: 2019-07-29 Last updated: 2019-07-29Bibliographically approved
Boge, L., Browning, K. L., Nordström, R., Campana, M., Darngaard, L. S. E., Caous, J. S., . . . Andersson, M. (2019). Peptide-Loaded Cubosomes Functioning as an Antimicrobial Unit against Escherichia coil. ACS Applied Materials and Interfaces, 11(24), 21314-21322
Open this publication in new window or tab >>Peptide-Loaded Cubosomes Functioning as an Antimicrobial Unit against Escherichia coil
Show others...
2019 (English)In: ACS Applied Materials and Interfaces, ISSN 1944-8244, E-ISSN 1944-8252, Vol. 11, no 24, p. 21314-21322Article in journal (Refereed) Published
Abstract [en]

Dispersions of cubic liquid crystalline phases, also known as cubosomes, have shown great promise as delivery vehicles for a wide range of medicines. Due to their ordered structure, comprising alternating hydrophilic and hydrophobic domains, cubosomes possess unique delivery properties and compatibility with both water-soluble and-insoluble drugs. However, the drug delivery mechanism and cubosome interaction with human cells and bacteria are still poorly understood. Herein, we reveal how cubosomes loaded with the human cathelicidin antimicrobial peptide LL-37, a system with high bacteria-killing effect, interact with the bacterial membrane and provide new insights into the eradication mechanism. Combining the advanced experimental techniques neutron reflectivity and quartz crystal microbalance with dissipation monitoring, a mechanistic drug delivery model for LL-37-loaded cubosomes on bacterial mimicking bilayers was constructed. Moreover, the cubosome interaction with Escherichia coli was directly visualized using super-resolution laser scanning microscopy and cryogenic electron tomography. We could conclude that cubosomes loaded with LL-37 adsorbed and distorted bacterial membranes, providing evidence that the peptide-loaded cubosomes function as an antimicrobial unit.

Place, publisher, year, edition, pages
American Chemical Society (ACS), 2019
Keywords
cubosome, antimicrobial peptide, LL-37, bacteria, membrane
National Category
Pharmacology and Toxicology
Identifiers
urn:nbn:se:uu:diva-390683 (URN)10.1021/acsami.9b01826 (DOI)000472683300004 ()31120236 (PubMedID)
Funder
EU, FP7, Seventh Framework Programme, 604182
Available from: 2019-08-14 Created: 2019-08-14 Last updated: 2019-08-14Bibliographically approved
Nordström, R. (2019). Polymeric Nanoparticles as Carriers for Antimicrobial Peptides: Factors Affecting Peptide and Membrane Interactions. (Doctoral dissertation). Uppsala: Acta Universitatis Upsaliensis
Open this publication in new window or tab >>Polymeric Nanoparticles as Carriers for Antimicrobial Peptides: Factors Affecting Peptide and Membrane Interactions
2019 (English)Doctoral thesis, comprehensive summary (Other academic)
Abstract [en]

As resistance towards conventional antibiotics is becoming more pronounced, cationic antimicrobial peptides (AMPs) have received considerable attention as possible therapeutic alternatives. Thousands of potent AMPs occur in humans, animals, plants and fungi as a natural part of the immune system. However, there are several challenges with AMP therapeutics related to formulation and delivery. Examples include proteolytic sensitivity and serum protein binding, resulting in quick degradation, loss of activity and clearance. Therefore, it is important to find a suitable drug delivery system to meet these protection and delivery challenges. Micro-/nanogels are loosely crosslinked polymer colloids with high water content that can be made to trigger at a wide range of stimuli. They have shown promise as delivery systems for AMPs, as the aqueous environment they create allows the peptides to maintain their natural conformation, while their gel networks offer protection and triggered release. This thesis aims towards expanding the knowledge about degradable and non-degradable pH-responsive micro-/nanogels as carriers for AMPs.

The results in this thesis show that factors relating to the drug delivery system (degradability, charge and crosslinker density), the surrounding media (pH and ionic strength) and the peptide properties (length, charge, PEGylation) all affect the peptide loading to, protection, release from and effect of AMP-loaded gels. Studies of the interaction of AMP-loaded microgels with bacteria-modelling liposomes and lipid bilayers have verified peptide effect after gel incorporation, as further demonstrated by in vitro studies on several bacterial strains. Neutron reflectometry provided detailed mechanistic information on the interaction between AMP-loaded gels and bacteria-modelling lipid bilayers, showing that the antimicrobial unit is the released peptide. All gels showed low, promising hemolysis and some gels could offer protection against proteolytic degradation of AMPs.

In summary, non-degradable and degradable micro-/nanogels are versatile and interesting candidates as AMP carriers. Small changes in the gel composition or the AMP used can dramatically change the peptide loading, release and effect. It is therefore necessary to carefully consider and evaluate the optimal carrier for every AMP and the application at hand.

Place, publisher, year, edition, pages
Uppsala: Acta Universitatis Upsaliensis, 2019. p. 74
Series
Digital Comprehensive Summaries of Uppsala Dissertations from the Faculty of Pharmacy, ISSN 1651-6192 ; 280
Keywords
antimicrobial peptide, microgel, degradable, nanogel, drug delivery, PEGylation, secondary structure, model membrane, lipid bilayer, neutron reflectometry, ellipsometry
National Category
Pharmaceutical Sciences Physical Chemistry
Research subject
Pharmaceutical Physical Chemistry
Identifiers
urn:nbn:se:uu:diva-383639 (URN)978-91-513-0778-7 (ISBN)
Public defence
2019-11-29, Room A1:107a, BMC, Husargatan 3, Uppsala, 09:15 (English)
Opponent
Supervisors
Available from: 2019-11-07 Created: 2019-10-12 Last updated: 2019-11-27
Nordström, R., Nyström, L., Andren, O. C. J., Malkoch, M., Umerska, A., Davoudi, M., . . . Malmsten, M. (2018). Membrane interactions of microgels as carriers of antimicrobial peptides. Journal of Colloid and Interface Science, 513, 141-150
Open this publication in new window or tab >>Membrane interactions of microgels as carriers of antimicrobial peptides
Show others...
2018 (English)In: Journal of Colloid and Interface Science, ISSN 0021-9797, E-ISSN 1095-7103, Vol. 513, p. 141-150Article in journal (Refereed) Published
Abstract [en]

Microgels are interesting as potential delivery systems for antimicrobial peptides. In order to elucidate membrane interactions of such systems, we here investigate effects of microgel charge density on antimicrobial peptide loading and release, as well as consequences of this for membrane interactions and antimicrobial effects, using ellipsometry, circular dichroism spectroscopy, nanoparticle tracking analysis, dynamic light scattering and z-potential measurements. Anionic poly(ethyl acrylate-co-methacrylic acid) microgels were found to incorporate considerable amounts of the cationic antimicrobial peptides LL-37 ([LL-37, 37 aa]) and DPK-060 (GKHKNKGKKNGKHNGWKWWW) and to protect incorporated peptides from degradation by infection-related proteases at high microgel charge density. As a result of their net negative z-potential also at high peptide loading, neither empty nor peptide-loaded microgels adsorb at supported bacteria-mimicking membranes. Instead, membrane disruption is mediated almost exclusively by peptide release. Mirroring this, antimicrobial effects against several clinically relevant bacteria (methicillin-resistant Staphylococcus aureus (MRSA), Escherichia coli, and Pseudomonas aeruginosa) were found to be promoted by factors facilitating peptide release, such as decreasing peptide length and decreasing microgel charge density. Microgels were further demonstrated to display low toxicity towards erythrocytes. Taken together, the results demonstrate some interesting opportunities for the use of microgels as delivery systems for antimicrobial peptides, but also highlight several key factors which need to be controlled for their successful use.

Place, publisher, year, edition, pages
ACADEMIC PRESS INC ELSEVIER SCIENCE, 2018
Keywords
Antimicrobial peptide, Drug delivery, Lipid membrane, Microgel
National Category
Physical Chemistry
Identifiers
urn:nbn:se:uu:diva-351759 (URN)10.1016/j.jcis.2017.11.014 (DOI)000428834900015 ()29145017 (PubMedID)
Funder
EU, FP7, Seventh Framework Programme, 604182
Available from: 2018-05-31 Created: 2018-05-31 Last updated: 2019-10-12Bibliographically approved
Nyström, L., Nordström, R., Strömstedt, A. A., Saunders, B., Alvarez-Asencio, R., Rutland, M. & Malmsten, M. (2018). Peptide-loaded microgels as antimicrobial surface coatings. Paper presented at 255th National Meeting and Exposition of the American-Chemical-Society (ACS) - Nexus of Food, Energy, and Water, MAR 18-22, 2018, New Orleans, LA. Abstract of Papers of the American Chemical Society, 255
Open this publication in new window or tab >>Peptide-loaded microgels as antimicrobial surface coatings
Show others...
2018 (English)In: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 255Article in journal, Meeting abstract (Other academic) Published
National Category
Physical Chemistry
Identifiers
urn:nbn:se:uu:diva-367230 (URN)000435539907572 ()
Conference
255th National Meeting and Exposition of the American-Chemical-Society (ACS) - Nexus of Food, Energy, and Water, MAR 18-22, 2018, New Orleans, LA
Available from: 2018-12-06 Created: 2018-12-06 Last updated: 2018-12-06Bibliographically approved
Nyström, L., Nordström, R., Bramhill, J., Saunders, B., Alvarez-Asencio, R., Rutland, M. & Malmsten, M. (2018). Peptide-loaded microgels as carriers of antimicrobial peptides. Paper presented at 255th National Meeting and Exposition of the American-Chemical-Society (ACS) - Nexus of Food, Energy, and Water, MAR 18-22, 2018, New Orleans, LA. Abstract of Papers of the American Chemical Society, 255
Open this publication in new window or tab >>Peptide-loaded microgels as carriers of antimicrobial peptides
Show others...
2018 (English)In: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 255Article in journal, Meeting abstract (Other academic) Published
National Category
Physical Chemistry
Identifiers
urn:nbn:se:uu:diva-367231 (URN)000435539907125 ()
Conference
255th National Meeting and Exposition of the American-Chemical-Society (ACS) - Nexus of Food, Energy, and Water, MAR 18-22, 2018, New Orleans, LA
Available from: 2018-12-06 Created: 2018-12-06 Last updated: 2018-12-06Bibliographically approved
Nordström, R., Nyström, L., Andren, O., Malkoch, M., Umerska, A., Davoudi, M., . . . Malmsten, M. (2018). Poly(acrylic acid) microgels as carriers for antimicrobial peptides. Paper presented at 255th National Meeting and Exposition of the American-Chemical-Society (ACS) - Nexus of Food, Energy, and Water, MAR 18-22, 2018, New Orleans, USA.. Abstract of Papers of the American Chemical Society, 255
Open this publication in new window or tab >>Poly(acrylic acid) microgels as carriers for antimicrobial peptides
Show others...
2018 (English)In: Abstract of Papers of the American Chemical Society, ISSN 0065-7727, Vol. 255Article in journal, Meeting abstract (Other academic) Published
Place, publisher, year, edition, pages
Washington, D.C.: American Chemical Society (ACS), 2018
National Category
Physical Chemistry
Identifiers
urn:nbn:se:uu:diva-368929 (URN)000435539907574 ()
Conference
255th National Meeting and Exposition of the American-Chemical-Society (ACS) - Nexus of Food, Energy, and Water, MAR 18-22, 2018, New Orleans, USA.
Note

Meeting Abstract: 797

Available from: 2018-12-11 Created: 2018-12-11 Last updated: 2018-12-11Bibliographically approved
Organisations
Identifiers
ORCID iD: ORCID iD iconorcid.org/0000-0001-5626-3959

Search in DiVA

Show all publications