uu.seUppsala universitets publikationer
Ändra sökning
RefereraExporteraLänk till posten
Permanent länk

Direktlänk
Referera
Referensformat
  • apa
  • ieee
  • modern-language-association
  • vancouver
  • Annat format
Fler format
Språk
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annat språk
Fler språk
Utmatningsformat
  • html
  • text
  • asciidoc
  • rtf
Nanoclay-induced bacterial flocculation for infection confinement
Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Farmaceutiska fakulteten, Institutionen för farmaci. (Farmaceutisk fysikalisk kemi, Pharmaceutical Physical Chemistry)ORCID-id: 0000-0001-5236-9107
Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Farmaceutiska fakulteten, Institutionen för läkemedelskemi. (Farmakognosi, Pharmacognosy)ORCID-id: 0000-0001-9070-6944
Visa övriga samt affilieringar
2019 (Engelska)Ingår i: Journal of Colloid and Interface Science, ISSN 0021-9797, E-ISSN 1095-7103, Vol. 562, s. 71-80Artikel i tidskrift (Refereegranskat) Published
Abstract [en]

Effects of size and charge of anionic nanoclays on their interactions with bacteria-mimicking lipid membranes, bacterial lipopolysaccharide (LPS), and Gram-negative bacteria were investigated using ellipsometry, dynamic light scattering, ζ-potential measurements, and confocal microscopy combined with Live/Dead staining. Based on particle size and charge density, three different anionic hectorite nanoclays were employed, and investigated in the presence and absence of the net cationic human antimicrobial peptide LL-37 ([LL-37, 37 aa]). In the absence of this peptide, the nanoclays were found not to bind to similarly anionic bacteria-mimicking model phospholipid membranes, nor to destabilize these. Similarly, while all nanoclays induced aggregation of Escherichia coli bacteria, the flocculated bacteria remained alive after aggregation. In contrast, LL-37 alone, i.e. in the absence of nanoclay particles, displays antimicrobial properties through membrane lysis, but does not cause bacterial aggregation in the concentration range investigated. After loading the nanoclays with LL-37, potent bacterial aggregation combined with bacterial membrane lysis was observed for all nanoclay sizes and charge densities. Demonstrating the potential of these combined systems for confinement of infection, LPS-induced NF-κB activation in human monocytes was found to be strongly suppressed after nanoclay-mediated aggregation, with a wide tolerance for nanoparticle size and charge density.

Ort, förlag, år, upplaga, sidor
Elsevier, 2019. Vol. 562, s. 71-80
Nyckelord [en]
Antimicrobial, Bacteria flocculation, Infection confinement, Membrane
Nationell ämneskategori
Farmaceutiska vetenskaper Läkemedelskemi
Identifikatorer
URN: urn:nbn:se:uu:diva-401401DOI: 10.1016/j.jcis.2019.11.110ISI: 000508752700008PubMedID: 31837621OAI: oai:DiVA.org:uu-401401DiVA, id: diva2:1383346
Forskningsfinansiär
Vetenskapsrådet, 2016-05157Tillgänglig från: 2020-01-07 Skapad: 2020-01-07 Senast uppdaterad: 2020-03-20Bibliografiskt granskad

Open Access i DiVA

Fulltext saknas i DiVA

Övriga länkar

Förlagets fulltextPubMed

Personposter BETA

Nyström, LinaStrömstedt, Adam A.

Sök vidare i DiVA

Av författaren/redaktören
Nyström, LinaStrömstedt, Adam A.
Av organisationen
Institutionen för farmaciInstitutionen för läkemedelskemi
I samma tidskrift
Journal of Colloid and Interface Science
Farmaceutiska vetenskaperLäkemedelskemi

Sök vidare utanför DiVA

GoogleGoogle Scholar

doi
pubmed
urn-nbn

Altmetricpoäng

doi
pubmed
urn-nbn
Totalt: 16 träffar
RefereraExporteraLänk till posten
Permanent länk

Direktlänk
Referera
Referensformat
  • apa
  • ieee
  • modern-language-association
  • vancouver
  • Annat format
Fler format
Språk
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annat språk
Fler språk
Utmatningsformat
  • html
  • text
  • asciidoc
  • rtf