uu.seUppsala University Publications
Change search
CiteExportLink to record
Permanent link

Direct link
Citation style
  • apa
  • ieee
  • modern-language-association
  • vancouver
  • Other style
More styles
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf
Nanoclay-induced bacterial flocculation for infection confinement
Uppsala University, Disciplinary Domain of Medicine and Pharmacy, Faculty of Pharmacy, Department of Pharmacy. (Farmaceutisk fysikalisk kemi, Pharmaceutical Physical Chemistry)ORCID iD: 0000-0001-5236-9107
Uppsala University, Disciplinary Domain of Medicine and Pharmacy, Faculty of Pharmacy, Department of Medicinal Chemistry. (Farmakognosi, Pharmacognosy)ORCID iD: 0000-0001-9070-6944
Show others and affiliations
2019 (English)In: Journal of Colloid and Interface Science, ISSN 0021-9797, E-ISSN 1095-7103, Vol. 562, p. 71-80Article in journal (Refereed) Published
Abstract [en]

Effects of size and charge of anionic nanoclays on their interactions with bacteria-mimicking lipid membranes, bacterial lipopolysaccharide (LPS), and Gram-negative bacteria were investigated using ellipsometry, dynamic light scattering, ζ-potential measurements, and confocal microscopy combined with Live/Dead staining. Based on particle size and charge density, three different anionic hectorite nanoclays were employed, and investigated in the presence and absence of the net cationic human antimicrobial peptide LL-37 ([LL-37, 37 aa]). In the absence of this peptide, the nanoclays were found not to bind to similarly anionic bacteria-mimicking model phospholipid membranes, nor to destabilize these. Similarly, while all nanoclays induced aggregation of Escherichia coli bacteria, the flocculated bacteria remained alive after aggregation. In contrast, LL-37 alone, i.e. in the absence of nanoclay particles, displays antimicrobial properties through membrane lysis, but does not cause bacterial aggregation in the concentration range investigated. After loading the nanoclays with LL-37, potent bacterial aggregation combined with bacterial membrane lysis was observed for all nanoclay sizes and charge densities. Demonstrating the potential of these combined systems for confinement of infection, LPS-induced NF-κB activation in human monocytes was found to be strongly suppressed after nanoclay-mediated aggregation, with a wide tolerance for nanoparticle size and charge density.

Place, publisher, year, edition, pages
Elsevier, 2019. Vol. 562, p. 71-80
Keywords [en]
Antimicrobial, Bacteria flocculation, Infection confinement, Membrane
National Category
Pharmaceutical Sciences Medicinal Chemistry
URN: urn:nbn:se:uu:diva-401401DOI: 10.1016/j.jcis.2019.11.110ISI: 000508752700008PubMedID: 31837621OAI: oai:DiVA.org:uu-401401DiVA, id: diva2:1383346
Swedish Research Council, 2016-05157Available from: 2020-01-07 Created: 2020-01-07 Last updated: 2020-03-20Bibliographically approved

Open Access in DiVA

No full text in DiVA

Other links

Publisher's full textPubMed

Authority records BETA

Nyström, LinaStrömstedt, Adam A.

Search in DiVA

By author/editor
Nyström, LinaStrömstedt, Adam A.
By organisation
Department of PharmacyDepartment of Medicinal Chemistry
In the same journal
Journal of Colloid and Interface Science
Pharmaceutical SciencesMedicinal Chemistry

Search outside of DiVA

GoogleGoogle Scholar


Altmetric score

Total: 6 hits
CiteExportLink to record
Permanent link

Direct link
Citation style
  • apa
  • ieee
  • modern-language-association
  • vancouver
  • Other style
More styles
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf