uu.seUppsala University Publications
Change search
CiteExportLink to record
Permanent link

Direct link
Cite
Citation style
  • apa
  • ieee
  • modern-language-association
  • vancouver
  • Other style
More styles
Language
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf
Bactericidal and hemolytic properties of mixed LL-37/surfactant systems
Uppsala University, Disciplinary Domain of Medicine and Pharmacy, Faculty of Pharmacy, Department of Pharmacy.
Uppsala University, Disciplinary Domain of Medicine and Pharmacy, Faculty of Pharmacy, Department of Pharmacy.
2007 (English)In: Journal of drug delivery science and technology, ISSN 1773-2247, Vol. 17, no 4, 293-297 p.Article in journal (Refereed) Published
Abstract [en]

The interaction between acyl chain homologues (C10 and C12) of n-acyl β-D-maltoside and the antimicrobial peptide LL-37 ([LL-37, 37 aa]) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leakage experiments, it was found that LL-37 interacts with both surfactants investigated, and that this reduces the effective free peptide concentration. Analogously, LL-37 displayed increased proteolytic stability towards Pseudomonas aeruginosa elastase in surfactant solution. Despite this, conditions can be found at which the bactericidal effect of mixed peptide-surfactant systems is comparable to that of free LL-37. However, also a number of challenges to this type of antimicrobial peptide (AMP) carrier system were identified, notably related to reduction of bactericidal effect for some systems, and occurrence of hemolysis for mixed peptide-surfactant systems displaying advantageous bactericidal effects. Any use of such AMP carrier systems will therefore have to be carefully optimized in order to retain bactericidal activity and minimize toxicity.

Place, publisher, year, edition, pages
2007. Vol. 17, no 4, 293-297 p.
Keyword [en]
Antibacterial agent, Drug carrier, Peptides, Acyl, Pharmaceutical technology, Micelle, Hemolysis, Bacteria, Antimicrobial agent, Surfactant
National Category
Pharmaceutical Sciences
Identifiers
URN: urn:nbn:se:uu:diva-13563ISI: 000250032200010OAI: oai:DiVA.org:uu-13563DiVA: diva2:41333
Available from: 2008-01-23 Created: 2008-01-23 Last updated: 2011-01-22Bibliographically approved

Open Access in DiVA

No full text

Authority records BETA

Malmsten, Martin

Search in DiVA

By author/editor
Malmsten, Martin
By organisation
Department of Pharmacy
Pharmaceutical Sciences

Search outside of DiVA

GoogleGoogle Scholar

urn-nbn

Altmetric score

urn-nbn
Total: 382 hits
CiteExportLink to record
Permanent link

Direct link
Cite
Citation style
  • apa
  • ieee
  • modern-language-association
  • vancouver
  • Other style
More styles
Language
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf