uu.seUppsala University Publications
Change search
CiteExportLink to record
Permanent link

Direct link
Cite
Citation style
  • apa
  • ieee
  • modern-language-association
  • vancouver
  • Other style
More styles
Language
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf
Primary and 3-D modelled structures of two cyclotides from Viola odorata
Uppsala University, Disciplinary Domain of Medicine and Pharmacy, Faculty of Pharmacy, Department of Medicinal Chemistry, Division of Pharmacognosy.
Uppsala University, Disciplinary Domain of Medicine and Pharmacy, Faculty of Pharmacy, Department of Medicinal Chemistry, Division of Pharmacognosy.
Show others and affiliations
2003 (English)In: Phytochemistry, ISSN 0031-9422, E-ISSN 1873-3700, Vol. 64, no 1, 135-142 p.Article in journal (Refereed) Published
Abstract [en]

Two polypeptides named vodo M and vodo N, both of 29 amino acids, have been isolated from Viola odorata L. (Violaceae) using ion exchange chromatography and reversed phase HPLC. The sequences were determined by automated Edman degradation, quantitative amino acid analysis, and mass spectrometry (MS). Using MS, it was established that vodo M (cyclo-SWPVCTRNGAPICGESCFTGKCYTVQCSC) and vodo N (cyclo-SWPVCYRNGLPVCGETCTLGKCYTAGCSC) form a head-to-tail cyclic backbone and that six cysteine residues are involved in three disulphide bonds. Their origin, sequences, and cyclic nature suggest that these peptides belong to the family of cyclic plant peptides, called cyclotides. The three-dimensional structures of vodo M and vodo N were modelled by homology, using the experimentally determined structure of the cyclotide kalata B1 as the template. The images of vodo M and vodo N show amphipathic structures with considerable surface hydrophobicity for a protein modelled in a polar environment.

Place, publisher, year, edition, pages
2003. Vol. 64, no 1, 135-142 p.
Keyword [en]
Viola odorata L., Violaceae, sweet violet, isolation, primary structure, homology modelling, cyclotide, macrocyclic polypeptide, vodo M, vodo N
National Category
Pharmaceutical Sciences
Identifiers
URN: urn:nbn:se:uu:diva-65226DOI: 10.1016/S0031-9422(03)00218-8PubMedID: 12946412OAI: oai:DiVA.org:uu-65226DiVA: diva2:93137
Available from: 2008-10-17 Created: 2008-10-17 Last updated: 2018-01-10Bibliographically approved

Open Access in DiVA

No full text

Other links

Publisher's full textPubMed

Authority records BETA

Göransson, UlfBacklund, Anders

Search in DiVA

By author/editor
Göransson, UlfBacklund, Anders
By organisation
Division of Pharmacognosy
In the same journal
Phytochemistry
Pharmaceutical Sciences

Search outside of DiVA

GoogleGoogle Scholar

doi
pubmed
urn-nbn

Altmetric score

doi
pubmed
urn-nbn
Total: 360 hits
CiteExportLink to record
Permanent link

Direct link
Cite
Citation style
  • apa
  • ieee
  • modern-language-association
  • vancouver
  • Other style
More styles
Language
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf