uu.seUppsala University Publications
Change search
ReferencesLink to record
Permanent link

Direct link
Membrane interactions of mesoporous silica nanoparticles as carriers of antimicrobial peptides
Univ Ulm, Dept Inorgan Chem 2, D-89031 Ulm, Germany..
Univ Ulm, Dept Inorgan Chem 2, D-89031 Ulm, Germany..
Univ Ulm, Dept Inorgan Chem 2, D-89031 Ulm, Germany..
Lund Univ, Dept Clin Sci, Div Dermatol & Venereol, SE-22184 Lund, Sweden..
Show others and affiliations
2016 (English)In: Journal of Colloid and Interface Science, ISSN 0021-9797, E-ISSN 1095-7103, Vol. 475, 161-170 p.Article in journal (Refereed) PublishedText
Abstract [en]

Membrane interactions are critical for the successful use of mesoporous silica nanoparticles as delivery systems for antimicrobial peptides (AMPs). In order to elucidate these, we here investigate effects of nanoparticle charge and porosity on AMP loading and release, as well as consequences of this for membrane interactions and antimicrobial effects. Anionic mesoporous silica particles were found to incorporate considerable amounts of the cationic AMP [LL-37, 37 aa] (LL-37), whereas loading is much lower for non-porous or positively charged silica nanoparticles. Due to preferential pore localization, anionic mesoporous particles, but not the other particles, protect LL-37 from degradation by infection-related proteases. For anionic mesoporous nanoparticles, membrane disruption is mediated almost exclusively by peptide release. In contrast, non-porous silica particles build up a resilient LL-37 surface coating due to their higher negative surface charge, and display largely particle-mediated membrane interactions and antimicrobial effects. For positively charged mesoporous silica nanoparticles, LL-37 incorporation promotes the membrane binding and disruption displayed by the particles in the absence of peptide, but also causes toxicity against human erythrocytes. Thus, the use of mesoporous silica nanoparticles as AMP delivery systems requires consideration of membrane interactions and selectivity of both free peptide and the peptide-loaded nanoparticles, the latter critically dependent on nanoparticle properties.

Place, publisher, year, edition, pages
2016. Vol. 475, 161-170 p.
Keyword [en]
Antimicrobial peptide, Drug delivery, Membrane, Mesoporous silica
National Category
Medicinal Chemistry
Identifiers
URN: urn:nbn:se:uu:diva-298829DOI: 10.1016/j.jcis.2016.05.002ISI: 000376708400019PubMedID: 27174622OAI: oai:DiVA.org:uu-298829DiVA: diva2:948392
Funder
EU, European Research Council, 604182
Available from: 2016-07-11 Created: 2016-07-11 Last updated: 2016-07-11Bibliographically approved

Open Access in DiVA

No full text

Other links

Publisher's full textPubMed

Search in DiVA

By author/editor
Malmsten, Martin
By organisation
Department of Pharmacy
In the same journal
Journal of Colloid and Interface Science
Medicinal Chemistry

Search outside of DiVA

GoogleGoogle Scholar
The number of downloads is the sum of all downloads of full texts. It may include eg previous versions that are now no longer available

Altmetric score

Total: 18 hits
ReferencesLink to record
Permanent link

Direct link