uu.seUppsala University Publications
Change search
CiteExportLink to record
Permanent link

Direct link
Cite
Citation style
  • apa
  • ieee
  • modern-language-association
  • vancouver
  • Other style
More styles
Language
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf
Cytotoxic cyclotides from Viola tricolor
Uppsala University, Medicinska vetenskapsområdet, Faculty of Pharmacy, Department of Medicinal Chemistry, Division of Pharmacognosy.
Uppsala University, Medicinska vetenskapsområdet, Faculty of Pharmacy, Department of Medicinal Chemistry, Division of Pharmacognosy.
Uppsala University, Medicinska vetenskapsområdet, Faculty of Medicine, Department of Medical Sciences. (Cancer Pharmacology and Informatics)
Show others and affiliations
Responsible organisation
2004 (English)In: Journal of natural products (Print), ISSN 0163-3864, E-ISSN 1520-6025, Vol. 67, no 2, 144-7 p.Article in journal (Refereed) Published
Abstract [en]

A crude fraction of Viola tricolor rich in small lipophilic proteins was prepared and subjected to fractionation guided by bioactivity, using RP-HPLC and a fluorometric cytotoxicity assay. Two human cancer cell lines, U-937 GTB (lymphoma) and RPMI-8226/s (myeloma), were used in this study. The most potent compounds isolated, that is, the compounds showing the lowest IC(50) values, were shown to be three small proteins: vitri A (IC(50) = 0.6 microM and IC(50) = 1 microM, respectively), varv A (IC(50) = 6 microM and IC(50) = 3 microM, respectively), and varv E (IC(50) = 4 microM in both cell lines). Their sequences, determined by automated Edman degradation, quantitative amino acid analysis, and mass spectrometry, were cyclo-GESCVWIPCITSAIGCSCKSKVCYRNGIPC (vitri A), cyclo-GETCVGGTCNTPGCSCSWPVCTRNGLPVC (varv A), and cyclo-GETCVGGTCNTPGCSCSWPVCTRNGLPIC (varv E), of which vitri A is described for the first time. Each forms a head-to-tail cyclic backbone, with six cysteine residues being involved in three disulfide bonds, characteristic of the family of small proteins called the cyclotides. This is the first report on cyclotides from the species V. tricolor and the first report on the sequence of the cytotoxic cyclotide vitri A.

Place, publisher, year, edition, pages
2004. Vol. 67, no 2, 144-7 p.
Keyword [en]
Amino Acid Sequence, Amino Acids/analysis, Cell Line; Tumor, Drug Screening Assays; Antitumor, Germany, Humans, Inhibitory Concentration 50, Molecular Sequence Data, Peptides; Cyclic/*chemistry, Plant Proteins/*chemistry, Plants; Medicinal/*chemistry, Research Support; Non-U.S. Gov't, Structure-Activity Relationship, Viola/*chemistry
National Category
Medical and Health Sciences
Identifiers
URN: urn:nbn:se:uu:diva-71902DOI: 10.1021/np030101lPubMedID: 14987049OAI: oai:DiVA.org:uu-71902DiVA: diva2:99813
Available from: 2007-02-08 Created: 2007-02-08 Last updated: 2017-11-21Bibliographically approved

Open Access in DiVA

No full text

Other links

Publisher's full textPubMedhttp://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed&cmd=Retrieve&list_uids=14987049&dopt=Citation

Authority records BETA

Svangård, ErikaGöransson, UlfGullbo, JoachimLarsson, RolfBohlin, Lars

Search in DiVA

By author/editor
Svangård, ErikaGöransson, UlfGullbo, JoachimLarsson, RolfBohlin, Lars
By organisation
Division of PharmacognosyDepartment of Medical Sciences
In the same journal
Journal of natural products (Print)
Medical and Health Sciences

Search outside of DiVA

GoogleGoogle Scholar

doi
pubmed
urn-nbn

Altmetric score

doi
pubmed
urn-nbn
Total: 369 hits
CiteExportLink to record
Permanent link

Direct link
Cite
Citation style
  • apa
  • ieee
  • modern-language-association
  • vancouver
  • Other style
More styles
Language
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Other locale
More languages
Output format
  • html
  • text
  • asciidoc
  • rtf