uu.seUppsala universitets publikasjoner
Endre søk
Begrens søket
45678910 301 - 350 of 1137
RefereraExporteraLink til resultatlisten
Permanent link
Referera
Referensformat
  • apa
  • ieee
  • modern-language-association
  • vancouver
  • Annet format
Fler format
Språk
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annet språk
Fler språk
Utmatningsformat
  • html
  • text
  • asciidoc
  • rtf
Treff pr side
  • 5
  • 10
  • 20
  • 50
  • 100
  • 250
Sortering
  • Standard (Relevans)
  • Forfatter A-Ø
  • Forfatter Ø-A
  • Tittel A-Ø
  • Tittel Ø-A
  • Type publikasjon A-Ø
  • Type publikasjon Ø-A
  • Eldste først
  • Nyeste først
  • Skapad (Eldste først)
  • Skapad (Nyeste først)
  • Senast uppdaterad (Eldste først)
  • Senast uppdaterad (Nyeste først)
  • Disputationsdatum (tidligste først)
  • Disputationsdatum (siste først)
  • Standard (Relevans)
  • Forfatter A-Ø
  • Forfatter Ø-A
  • Tittel A-Ø
  • Tittel Ø-A
  • Type publikasjon A-Ø
  • Type publikasjon Ø-A
  • Eldste først
  • Nyeste først
  • Skapad (Eldste først)
  • Skapad (Nyeste først)
  • Senast uppdaterad (Eldste først)
  • Senast uppdaterad (Nyeste først)
  • Disputationsdatum (tidligste først)
  • Disputationsdatum (siste først)
Merk
Maxantalet träffar du kan exportera från sökgränssnittet är 250. Vid större uttag använd dig av utsökningar.
  • 301.
    Huang, Xiao
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC.
    Yang, Li
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    The n-type Polymers Pending with Terephthalate Group Attempt for Organic Anode Material2014Konferansepaper (Annet vitenskapelig)
  • 302.
    Huang, Xiao
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Syntetisk organisk kemi.
    Yang, Li
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Bergquist, Jonas
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Analytisk kemi.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Gogoll, Adolf
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Syntetisk organisk kemi.
    Sjödin, Martin
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Synthesis and Redox Properties of Thiophene Terephthalate Building Blocks for Low-Potential Conducting Redox Polymers2015Inngår i: The Journal of Physical Chemistry C, ISSN 1932-7447, E-ISSN 1932-7455, Vol. 119, nr 49, s. 27247-27254Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Terephthalate-substituted thiophene derivatives are promising redox-active components for anode materials in lithium-ion batteries. In this study, we present the synthesis of substituted 2-(thiophen-3-yl)terephthalate derivatives (TTDs) as suitable monomers for thiophene-based conducting redox polymers, along with their characterization by electrochemical and spectroscopic techniques. Density functional theory (DFT) calculations, utilizing the universal solvation model based on solute electron density (SMD), were used to predict both the first and the second reduction potentials of these TTDs. The computational results showed good agreement with the experimental data in nonaqueous acetonitrile solvent, with mean absolute errors of 30 and 40 mV for the first and second reduction steps, respectively. Time-dependent (TD) DFT calculations on TTDs indicated terephthalate local transitions at both 200 and 240 nm and charge-transfer transitions above 300 nm by examination of the involved molecular orbitals.

  • 303.
    Huang, Xiao
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Organisk kemi.
    Yang, Li
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Emanuelsson, Rikard
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Bergquist, Jonas
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för fysikalisk och analytisk kemi, Analytisk kemi.
    Strømme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Sjödin, Martin
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Gogoll, Adolf
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Organisk kemi.
    A versatile route to polythiophenes with functional pendant groups using alkyne chemistry2016Inngår i: Beilstein Journal of Organic Chemistry, ISSN 2195-951X, E-ISSN 1860-5397, Vol. 12, s. 2682-2688Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    A new versatile polythiophene building block, 3-(3,4-ethylenedioxythiophene)prop-1-yne (pyEDOT) (3), is prepared from glycidol in four steps in 28% overall yield. pyEDOT features an ethynyl group on its ethylenedioxy bridge, allowing further functionalization by alkyne chemistry. Its usefulness is demonstrated by a series of functionalized polythiophene derivatives that were obtained by pre- and post-electropolymerization transformations, provided by the synthetic ease of the Sonogashira coupling and click chemistry.

  • 304.
    Huang, Xiao
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Syntetisk organisk kemi.
    Yang, Li
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Sjödin, Martin
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Gogoll, Adolf
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Syntetisk organisk kemi.
    The n-type polymers pending with terephthalate group attempt for organic anode material2014Konferansepaper (Fagfellevurdert)
  • 305.
    Huang, Xiao
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Syntetisk organisk kemi.
    Yang, Li
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Sjödin, Martin
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Gogoll, Adolf
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Syntetisk organisk kemi.
    The n-type polymers with terephthalate group attempt for organic anode material2014Konferansepaper (Fagfellevurdert)
  • 306.
    Huang, Xiao
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Syntetisk organisk kemi.
    Yang, Li
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Gogoll, Adolf
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Syntetisk organisk kemi.
    Sjödin, Martin
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Synthesis and Redox Properties of Thiophene-Terephthalate Building Blocks for Low Potential Conducting Redox Polymers2015Inngår i: 66th Annual Meeting of the International Society of Electrochemistry Proceeding., 2015Konferansepaper (Fagfellevurdert)
  • 307.
    Huang, Xiao
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Organisk kemi.
    Yang, Li
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Sjödin, Martin
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Gogoll, Adolf
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC, Organisk kemi.
    3-(3,4-ethylenedioxythiophene)prop-1-yne (pyEDOT): A new versatile building block for functionalized PEDOTs2016Inngår i: 25th Organikerdagarna, 2016Konferansepaper (Fagfellevurdert)
  • 308.
    Hulsart Billström, Gry
    et al.
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för kirurgiska vetenskaper, Ortopedi. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Janson, Oscar
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Hong, Jaan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Fasta tillståndets fysik. Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Medicinska fakulteten, Institutionen för immunologi, genetik och patologi, Klinisk immunologi.
    Thromboinflammation as bioactivity assessment of H2O2-alkali modified titanium surfaces2019Inngår i: Journal of materials science. Materials in medicine, ISSN 0957-4530, E-ISSN 1573-4838, Vol. 30, nr 6, artikkel-id 66Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    The release of growth factors from platelets, mediated by the coagulation and the complement system, plays an important role in the bone formation around implants. This study aimed at exploring the thromboinflammatory response of H2O2-alkali soaked commercially pure titanium grade 2 discs exposed to whole human blood, as a way to assess the bioactivity of the discs. Commercially pure titanium grade 2 discs were modified by soaking in H2O2, NaOH and Ca(OH)2. The platelet aggregation, coagulation activation and complement activation was assessed by exposing the discs to fresh whole blood from human donors. The platelet aggregation was examined by a cell counter and the coagulation and complement activation were assessed by ELISA-measurements of the concentration of thrombin-antithrombin complex, C3a and terminal complement complex. The modified surface showed a statistically significant increased platelet aggregation, coagulation activation and complement activation compared to unexposed blood. The surface also showed a statistically significant increase of coagulation activation compared to PVC. The results of this study showed that the H2O2-alkali soaked surfaces induced a thromboinflammatory response that indicates that the surfaces are bioactive.

  • 309.
    Hultberg, Jonas
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Point source carbon capture by porous inorganic carbonates2018Independent thesis Advanced level (professional degree), 20 poäng / 30 hpOppgave
    Abstract [en]

    Mesoporous inorganic carbonates (MIC) was synthesized and tested as adsorbents for

    CO2, using vacuum and temperature swing adsorption. Mesoporous magnesium

    carbonate (MMC), mesoporous calcium carbonate (MCC) and mesoporous calcium

    magnesium carbonate (MCMC), all included in MIC, are exceedingly porous with an

    amorphous structure. MMC was first reported in 2013, where it was synthesized in a

    methanol and MgO mixture under CO2 pressure. In this work, the synthesis of MCC and

    MCMC was developed from the synthesis of MMC. Further effects on the CO2 adsorption

    characteristics of the MIC materials with several additives (Al(NO3)3, Al2O3, K2CO3 and

    KNO3) introduced into the porous structures were also investigated.

    The  MCC  materials CO2 adsorption capacity (14.96 mmol g-1) was drastically lowered

    (7.29 mmol g-1) by severe sintering after continuous cycles when heat was used for

    sorbent regeneration. The combined structure of MCMC improved the stability,

    mitigating the sintering for high temperature adsorption/desorption (650 °C, 850 °C). The

    addition of Al(NO3)3 improved the stability further, with an optimum additive amount of

    35 wt.%, giving a high initial CO2 uptake (12.23 mmol g-1) and maintaining a high CO2

    uptake after 23 cycles (10.96 mmol g-1).

    The pure gas CO2 uptake of MMC was around 1.52 mmol g-1 at 101 kPa (0 °C) using

    vacuum swing adsorption. The N2 uptake under the same conditions was less than 0.10

    mmol g-1. All of the additives tested increased the CO2 uptake of MIC under these

    conditions, with the most promising additives being low weight percentages of potassium

    carbonate (5-10 wt.%) added to MMC for low temperature adsorption (0 °C). The

    incorporation of 5 wt.% K2CO3 increased the CO2 uptake of MMC up to 3.24 mmol g-1,

    suggesting that the required energy for adsorption on this sample, due to the sorbent

    surpassing 3 mmol g-1 CO2 capacity, could be less than for conventional chemical

    absorbents.

    Vacuum swing cyclic CO2 adsorption/desorption showed a decrease in CO2 uptake on

    MMC with 5 wt.% K2CO3 after each cycle. Heat regeneration (150 °C, for 30 minutes)

    could recover most of the lost CO2 capacity each cycle. Heat indicatively improved the

    cyclic performance of this adsorbent without damaging the nanoporous structure. MMC

    with 5 wt.% K2CO3 was the best performing adsorbent when vacuum was used for sorbent

    regeneration and can potentially be further developed into a good CO2 adsorbent for

    temperature swing adsorption (TSA) processes.

  • 310.
    Hägerström, Helene
    et al.
    Uppsala universitet, Medicinska vetenskapsområdet, Farmaceutiska fakulteten, Institutionen för farmaci. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material. Nanoteknologi och funktionella material.
    Edsman, Katarina
    Uppsala universitet, Medicinska vetenskapsområdet, Farmaceutiska fakulteten, Institutionen för farmaci. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Drug molecules as probes for studying the compatibility between gels and mucous tissue with dielectric spectroscopy.2005Inngår i: J Pharm Sci, ISSN 0022-3549, Vol. 94, nr 5, s. 1090-1100Artikkel i tidsskrift (Fagfellevurdert)
  • 311.
    Ikemoto, Hideki
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Incorporation of model drug and release from mesoporous silica nanoparticles2008Rapport (Fagfellevurdert)
  • 312. Inge, Andrew Kentaro
    et al.
    Wang, Yunchen
    Takki, Sofia
    Cheung, Ocean
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Xu, Hongyi
    Wan, Wei
    Öhrström, Lars
    Zou, Xiaodong
    O’Keeffe, Michael
    Stock, Norbert
    Bismuth coordination polymers: from centuries-old medicines to unprecedented topological complexity2017Inngår i: Acta Crystallographica Section A, Vol. 73, nr a2Artikkel i tidsskrift (Fagfellevurdert)
  • 313. Izquierdo-Barba, Isabel
    et al.
    Vallet-Regí, María
    Kupferschmidt, Natalia
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Terasaki, Osamu
    Schmidtchen, Artur
    Malmsten, Martin
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Farmaceutiska fakulteten, Institutionen för farmaci.
    Incorporation of antimicrobial compounds in mesoporous silica film monolith2009Inngår i: Biomaterials, ISSN 0142-9612, E-ISSN 1878-5905, Vol. 30, nr 29, s. 5729-5736Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieved without greatly affecting the structure of the mesoporous silica. The modified mesoporous silica released LL-37 and chlorhexidine slowly, reaching maximum release after about 200 h. The release rate could also be controlled through incorporation of SH groups in the pore walls, adding to pore hydrophobicity and reducing the release rate by about 50% compared to the unmodified mesoporous silica. Mesoporous silica containing either LL-37 or chlorhexidine displayed potent bactericidal properties against both Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli. While chlorhexidine-loaded mesoporous silica displayed an accompanying high toxicity, as judged from hemolysis, LDH release, and MTT assay, the corresponding material containing LL-37 showed very low toxicity by all these assays, comparable to that observed for mesoporous silica in the absence of antibacterial drug, as well as to the negative controls in the respective assays. Mesoporous silica containing LL-37 therefore holds potential as an implantable material or a surface coating for such materials, as it combines potent bactericidal action with low toxicity, important features for controlling implant-related infections, e.g., for multi-resistant pathogens or for cases where access to the infection site of systemically administered antibiotics is limited due to collagen capsule formation or other factors.

  • 314.
    Jafri, Hassan
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Blom, Tobias
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Leifer, Klaus
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Using a nano-contact platform for evaluating molecular electronics response2009Konferansepaper (Annet vitenskapelig)
  • 315.
    Jafri, Hassan
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Experimentell fysik.
    Blom, Tobias
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Experimentell fysik.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Leifer, Klaus
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Experimentell fysik.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Systematic assessment of a nanoparticle bridge platform for molecular electronics measurementsManuskript (preprint) (Annet vitenskapelig)
    Abstract [en]

    A combination of electron beam lithography, photolithography and focused ion beam milling was used to create a nanogap platform, which was bridged by gold nanoparticles (AuNPs) in order to make electrical measurements and assess the platform under ambient conditions. Initially bare electrodes were tested to determine the response of the platform and it was found that creating devices in ambient conditions requires careful cleaning processes and awareness of the contributions contaminants may make to measurements. Both octanethiol (OT) and Biphenyldithiol (BPDT) molecules were also tested by functionalizing the nanoelectrodes with the molecules prior to bridging the nanogap with the nanoparticles. Measurements on OT show that it is possible to make measurements on relatively small numbers of molecules, but that a large variation in response can be expected when one of the metal-molecule junctions is physisorbed, which was partially explained by attachment of OT molecules to different sites on the surface of the Au electrode using a density function theory calculation. On the other hand, when dealing with BPDT, high yields for device creation are very difficult to achieve when preparing the devices in ambient conditions. Significant hysteresis, or conductance switching, in the I-V curves of BPDT was also observed, which we attribute primarily to voltage induced changes at the interface between the molecule and the metal.

  • 316.
    Jafri, S. Hassan M.
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Experimentell fysik. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Blom, Tobias
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Experimentell fysik. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Leifer, Klaus
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Experimentell fysik. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Löfås, Henrik
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi.
    Grigoriev, Anton
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi.
    Ahuja, Rajeev
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Assessment of a nanoparticle bridge platform for molecular electronics measurements2010Inngår i: Nanotechnology, ISSN 0957-4484, E-ISSN 1361-6528, Vol. 21, nr 43, s. 435204-Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    A combination of electron beam lithography, photolithography and focused ion beam milling was used to create a nanogap platform, which was bridged by gold nanoparticles in order to make electrical measurements and assess the platform under ambient conditions. Non-functionalized electrodes were tested to determine the intrinsic response of the platform and it was found that creating devices in ambient conditions requires careful cleaning and awareness of the contributions contaminants may make to measurements. The platform was then used to make measurements on octanethiol (OT) and biphenyldithiol (BPDT) molecules by functionalizing the nanoelectrodes with the molecules prior to bridging the nanogap with nanoparticles. Measurements on OT show that it is possible to make measurements on relatively small numbers of molecules, but that a large variation in response can be expected when one of the metal–molecule junctions is physisorbed, which was partially explained by attachment of OT molecules to different sites on the surface of the Au electrode using a density functional theory calculation. On the other hand, when dealing with BPDT, high yields for device creation are very difficult to achieve under ambient conditions. Significant hysteresis in the IV curves of BPDT was also observed, which was attributed primarily to voltage induced changes at the interface between the molecule and the metal.

  • 317.
    Jafri, S Hassan M
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Blom, Tobias
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Wallner, Andreas
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för biokemi och organisk kemi.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strømme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Ottosson, Henrik
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för biokemi och organisk kemi.
    Leifer, Klaus
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Control of junction resistances in molecular electronic devices fabricated by FIB2011Inngår i: Microelectronic Engineering, ISSN 0167-9317, E-ISSN 1873-5568, Vol. 88, nr 8, s. 2629-2631Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    A major hurdle to realize molecular electronic devices (MEDs) is to make reliable electrical contacts to a single or a few molecules. Our nano-contact platform with a gap size of less than 25 nm with resistances above 1000 TΩ was built using combined techniques of photolithography, electron beam lithography and focused ion beam milling. In this study, we have used gold nanoparticles (AuNPs) to bridge the nanoelectrode gaps by dielectrophoretic trapping and thus obtain electrical contacts. The electrodes and/or the nanoparticles were functionalised with 1–2 nm long alkane-thiol molecules so that the electronic structure of these molecules determines the properties of the electrical junction. Molecules were introduced both by functionalising the nanogap and the nanoparticles and the results of both functionalisation protocols are compared. Here, we show the nanogap–nanoparticle bridge set-up containing metal–molecule junctions that can be used as a base for the development of molecular electronics containing only a few molecules under ambient conditions. Current–voltage (IV) characterization of alkanethiol/gold junction showed non-linear response where mean geometric resistance of four different junctions could be tuned from 20 GΩ to 20 TΩ. The results from the measurements on 1-alkanethiol in such devices is a first step to demonstrate that this platform has the potential to obtain stable electronic devices having relatively small numbers of molecules with reliable metal molecule junction by combing top-down and bottom-up approaches.

  • 318.
    Jafri, S.Hassan M.
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Experimentell fysik.
    Blom, Tobias
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Experimentell fysik.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Löfås, Henrik
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi, Teoretisk fysik.
    Grigoriev, Anton
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi, Teoretisk fysik.
    Ahuja, Rajeev
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi, Teoretisk fysik.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Leifer, Klaus
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Experimentell fysik.
    Control of junction resistances in molecular electronic devices fabricated by FIB2010Inngår i: 36th International Conference on Micro and Nano Engineering, MNE2010, Italy (2010), 2010Konferansepaper (Fagfellevurdert)
    Abstract [en]

    Molecules provide an opportunity to fabricate electronic devices with much smaller basic unit in size i.e. 1-5 nm as compared to today’s silicon based electronics. Furthermore, molecules can be synthesized withalmost unlimited variation of their electronic structure. Theoretically, molecules in various configurations were demonstrated as rectifiers, transistors or memories, but experimentally it is still very difficult to obtaina  stable and reproducible molecular based device [1]. A major hurdle to realize such devices is to make reliable electrical contacts to a single or a few molecules. Here, we show the first reproducible and systematic evaluation of a nanogap-nanoparticle bridge set-up that can be used as base for development of few molecule molecular electronics under ambient conditions. We have developed a nano-contact platform by top-down approach [2] with a gap size of 20-30nm using combined techniques of photolithography, electron beam lithography and focused ion beam milling (Fig 1). These gaps demonstrate excellent resistance in order of 1000 TΩ enabling us to carry out electrical characterization of highly resistive nanomaterials.However, compared to the size of molecules these gaps are quite big. In this study, we used metallic nanoparticles to bridge the gap and thus obtain electrical contacts with 1-2nm long molecules in the junction between the nanoelectrodes and the nanoparticles. The nanoparticles are assembled in the gap  by a bottom-up approach using dielectrophrosis trapping process. Prior to introduction of molecules in such devices, we found that the trapping of gold nanoparticles (AuNP) in between clean nanoelectrodes without presence of molecules often gave resistance in order of mega-ohms to giga-ohms due to presence of a non conductive barrier. However, it was observed that cleaning protocols of both the gold contacts and nanoparticles in solution lead to resistance of less than a few hundreds of ohms (Fig 2). Molecules were introduced both by functionalizing the electrode gap and the the nanoparticles and the results of both functionalisation protocols are compared. By optimizing the electrode cleaning as well as the functionalisation of the metallic surfaces, we obtain reproducible electrical measurements. We fabricated such devices either by depositing a Self Assembled Monolayer (SAM) of molecules on the nano-contacts and bridging the gap by AuNP or by bridging the clean nano-contacts with molecule-coated-AuNP (Fig 3). Here we utilized a model molecules octanethiol (OT), octanedithiol and biphenyldithiol in fabrication of devices and study of metal molecule junction resistance. IV characterization of OT molecules (Fig 4) showed linear response where current levels varied between picoamps and femtoamps with an applied voltage of 1-3V. OT in this setup had one physisorbed contact with gold, which resulted in much less wave function mixing at the molecule-metal interface, and consequently decreased the transmission probability at the molecule-electrode interface. As a result, in the evaluation of more than 50 devices, a considerable variation of resistance between different devices due to the lack of covalent binding, the variation in number of trapped AuNPs, incomplete coverage of OT on the uneven surface of nanoelectrodes and variation in contact surface geometry. Density functional theory is used to understand the origin of the resistance fluctuation. We were able to estimate the average resistance per octanethiol molecule for such device in order of 175GΩ, in good agreement with other published results. Our results with the measurements on OT in such devices demonstrate that it is possible to fabricate stable electronic devices having relatively small numbers of molecules with reliable metal molecule junction by combing top-down and bottom-up approaches. By functionalizing the nanoparticles, we obtained a strong decrease of the resistance spread of such devices from 3 orders of magnitude to about 1 order of magnitude, making this technology a potential approach for molecular devices operating at ambient conditions.

     

  • 319.
    Jafri, Syed Hassan Mujtaba
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Blom, Tobias
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Leifer, Klaus
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Nanoparticle Bridges for Studying Electrical Properties of Organic Molecules2012Inngår i: Nanoparticles in Biology and Medicine: / [ed] Soloviev, M., Springer Publishing Company, 2012, s. 535-546Kapittel i bok, del av antologi (Fagfellevurdert)
  • 320. Janer, G
    et al.
    Park, M
    Catalán, J
    Ferraz, Natalia
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Cabellos, J
    Vanhauten, R
    Challenges and lessons learnt during the implementation into the GUIDEnano Tool of a systematic evaluation of similarity between nanomaterials.2017Konferansepaper (Fagfellevurdert)
  • 321.
    Janson, Oscar
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Gururaj, Satwik
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Pujari-Palmer, Shiuli
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Karlsson Ott, Marjam
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Strømme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Titanium surface modification to enhance antibacterial and bioactive properties while retaining biocompatibility2019Inngår i: Materials science & engineering. C, biomimetic materials, sensors and systems, ISSN 0928-4931, E-ISSN 1873-0191, Vol. 96, s. 272-279Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Bacterial infections associated with metal implants are severe problems affecting a considerable amount of people with dental or orthopedic implants. This study aims to examine the antibacterial effect of a Titanium-peroxy gel layer on the modified surface of commercially pure titanium grade 2. Variations in a multi-step surface modification procedure were tested to determine the best combination that provided an antibacterial effect while enhancing bioactivity without compromising biocompatibility. Soaking the surfaces in 30 wt% hydrogen peroxide held at 80 °C provided antibacterial activity while subsequent surface treatments in concentrated sodium and calcium hydroxide solutions were preformed to enhance bioactivity. Staphylococcus epidermidis was used to determine the antibacterial effect through both direct contact and biofilm inhibition tests while human dermal fibroblast cells and MC3T3 pre osteoblast cells were utilized to test biocompatibility. The greatest antibacterial effect was observed with only hydrogen peroxide treatment, but the resulting surface was neither bioactive nor biocompatible. It was found that subsequent surface treatments with sodium hydroxide followed by calcium hydroxide provided a bioactive surface that was also biocompatible. Additionally, a final treatment with autoclaving showed positive effects with regards to enhanced bioactivity. This multi-step surface modification procedure offers a promising, non-antibiotic, solution for combatting infections associated with biomedical implants.

  • 322.
    Janson, Oscar
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Gururaj, Satwik
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Pujari-Palmer, Shiuli
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Karlsson Ott, Marjam
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Modification of titanium surfaces to enhance bacteriostatic properties2016Konferansepaper (Fagfellevurdert)
    Abstract [en]

    Introduction: Infections caused by bacterial biofilm on dental implants affect a considerable amount of patients. Anodic oxidation and physical vapor deposition are current methods in modifying the surface of implants in order to make them more resistant to bacterial biofilm formation[1]. An easier and economically attractive method is soaking the surface in hydrogen peroxide (H2O2), sodium hydroxide (NaOH) and calcium dihyroxide (Ca(OH)2). This method is hypothesized to not only provide antibacterial activity, but also preserve the bioactive properties and biocompatibility of the surface. The aim of this study was to determine which surface treatment provides the best antibacterial effect, as well as examine if the addition of calcium ions results in additional bioactivity.

    Method: Discs of grade 2 Ti were punched into circular coins with diameter 9 mm and 1 mm thickness. The coins were sequentially sonicated for 15 min in acetone, ethanol and dH2O, before being immersed in H2O2 for 1 h at 90 °C. Subsequently the coins were soaked in NaOH for 15 min. The coins were divided in six test groups where three groups were further soaked in Ca(OH)2 for 15 min and then either heated at 200 °C for 1 h (Ti200_Ca), autoclaved at 125°C for 1 h (TiAuto_Ca), or simply kept at room temperature for 1 h (Ti25_Ca). The remaining three groups received the same final heat treatment, but without the soaking in Ca(OH)2 (Ti200 TiAuto and Ti25, respectively). The coins were then immersed in Dulbecco’s PBS enriched with Ca2+- and Mg2+-ions in an incubator at 37 °C for 7 days. The coin surfaces were examined for hydroxyapatite (HA) in a LEO 1550 scanning electron microscope.

    The coins were checked for H2O2 release by studying the degradation of the organic dye rhodamine B.

    Two cell lines; MC3T3 murine preosteoblasts and human dermal fibroblasts (hDF) were seeded onto the coins. Cell viability was measured after 3 days using the Alamar Blue assay.

    Results: The test groups soaked in Ca(OH)2 showed a higher degree of HA formation compared to the test groups not soaked in Ca(OH)2, see Fig. 1. Treatment in room temperature showed better HA formation than 200 °C and autoclaving. The rhodamine B degradation test showed that the test groups Ti200_Ca, TiAuto_Ca, Ti25 and Ti200 showed approximately 30 % degradation after 7 days (Fig. 2). The hDF cells had no observed changes in cell viability as compared to the control after 3 days. The MC3T3s, however, had greater proliferation on the modified coins, compared to the unmodified Ti (Fig. 3). 

     

    Discussion and conclusions: Calcium ion addition increased the bioactivity, providing more available sites for phosphate to bind to calcium. Preliminary tests with rhodamine B suggest an antibacterial activity of the modified surfaces. Future studies will be conducted to further investigate this potential effect with bacteria. 

    Vinnova

    References:[1] LIU, X., CHU, P., & DING, C. (2004). Surface modification of titanium, titanium alloys, and related materials for biomedical applications. Materials Science and Engineering: R: Reports, 47(3-4), 49–121. doi:10.1016/j.mser.2004.11.001

  • 323.
    Janson, Oscar
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Gururaj, Satwik
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Pujari-Palmer, Shiuli
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Karlsson Ott, Marjam
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Titanium surface modification leading to increased antibacterial ability, bioactivity and biocompatibility2016Konferansepaper (Fagfellevurdert)
    Abstract [en]

    Introduction

    Bacterial biofilms can adhere to implants, and may ultimately lead to implant failure. One way to prevent bacterial biofilm formation is to modify the surface to make it antibacterial or bacteriostatic. A straightforward and economically attractive modification method is to soak the surface in hydrogen peroxide, sodium hydroxide and calcium dihyroxide. Hydrogen peroxide has been found to make the surface anti-inflammatory[1] and perhaps antibacterial. Sodium hydroxide has been seen to render the surface bioactive[2], while calcium hydroxide might further increase the bioactivity. In this study we investigated the antibacterial properties, bioactivity and biocompatibility of this surface modification method.

     

    Methods

    Coupons of cpTi (grade 2) were immersed in H2O2 for 1 h at 80 °C and then soaked in NaOH. Some test groups were also soaked in Ca(OH)2. After soaking, coupons were heat treated at 200 °C, autoclaved at 125 °C for 1 h or simply kept at room temperature. To investigate bioactivity the coupons were immersed in SBF for 7 days. Biocompatibility was assessed by seeding two cell lines on the modified titanium surfaces. To investigate the antibacterial effect, bacterial biofilms were grown on the surfaces for 16 h and assessed for viability with luminescence readings.

     

    Results

    Ca(OH)2 modified coupons showed an increased bioactivity compared to coupons only soaked in NaOH. Hydroxyapatite formation was strongest for test groups placed in room temperature or 200 °C. Cell proliferation was increased with human dermal fibroblast. Autoclaved surfaces showed a decreased luminescence signal compared to the control, indicating inhibition of bacterial biofilm.

     

    Conclusions

    Coupons soaked in Ca(OH)2 after soaking in NaOH showed increased bioactivity compared to coupons only soaked in NaOH. Further they exhibit excellent biocompatibility and some degree of antibacterial behavior.

     

     

    [1]       P. Tengvall, I. Lundström, L. Sjöqvist, H. Elwing, L.M. Bjursten, Biomaterials 10 (1989) 166.

    [2]       X. LIU, P. CHU, C. DING, Materials Science and Engineering: R: Reports 47 (2004) 49.

  • 324.
    Janson, Oscar
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Effect of irradiated TiO2/H2O2 suspensions on Staphylococcus epidermidis biofilm2017Inngår i: 10th annual meeting for Scandinavian Society for Biomaterials (ScSB) 2017: Underlying Challenges in Biomaterials, 2017, artikkel-id 15Konferansepaper (Fagfellevurdert)
  • 325.
    Janson, Oscar
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Strømme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Debridement of Bacterial Biofilms with TiO2/H2O2 Solutions and Visible Light Irradiation2018Inngår i: International Journal of Biomaterials, ISSN 1687-8787, E-ISSN 1687-8795, Vol. 2018, artikkel-id 5361632Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Objectives. The aim of the study was to explore the debridement efficacy of different solutions of H2O2 and rutile particles against Staphylococcus epidermidis and Pseudomonas aeruginosa biofilms attached to titanium surfaces when exposed to visible light. Materials and Methods. Titanium discs cultivated with biofilms of Staphylococcus epidermidis or Pseudomonas aeruginosa were subjected for 1 min to suspensions consisting of rutile particles mixed with high (950 mM) or low (2 mM) concentrations of H2O2 under visible light irradiation (405 nm; 2.1 mW/cm2). Discs were rinsed and the degree of debridement was determined through scanning electron microscopy and viability assessment of the remaining bacteria using luminescence measurements and/or a metabolic activity assay. Results. Cleaning mixtures containing the higher concentration of H2O2 showed a significantly improved debridement compared to the negative control in all experiments. The addition of rutile particles was shown to have a statistically significant effect in one test with S. epidermidis. Limited evidence of the catalytic effect of visible light irradiation was seen, but effects were relatively small and statistically insignificant. Conclusions. H2O2 at a concentration of 950 mM proved to be the strongest contribution to the debridement and bactericidal effect of the cleaning techniques tested in this study.

  • 326.
    Janson, Oscar
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Strømme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Effect of irradiated TiO2/H2O2 suspensions on Staphylococcus epidermidis biofilm2017Inngår i: European Cells and Materials, ISSN 1473-2262, E-ISSN 1473-2262Artikkel i tidsskrift (Fagfellevurdert)
  • 327.
    Janson, Oscar
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Sörensen, Jan Henrik
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Fasta tillståndets fysik.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Procter, Philip
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Development of a novel multifunctional hydroxyapatite coating for orthopedic implantsManuskript (preprint) (Annet vitenskapelig)
  • 328.
    Janson, Oscar
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Sörensen, Jan Henrik
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Procter, Philip
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Evaluation of an alkali-treated and hydroxyapatite-coated orthopedic implant loaded with tobramycin2019Inngår i: Journal of biomaterials applications, ISSN 0885-3282, E-ISSN 1530-8022Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    An approximately 1-µm thick hydroxyapatite coating was biomimetically deposited on an alkali-treated, commercially available orthopedic screw surface (type II anodized titanium). Tobramycin loaded into the coating via a simple soaking method was shown to provide a sustained release above the minimal inhibitory concentration 0.2 µg/µl for up to two days. Agar diffusion tests showed that the tobramycin-loaded coating was able to produce a zone of inhibition against Staphylococcus aureus for up to five days. Biocompatibility testing using outgrowth endothelial cells and primary osteoblasts suggested that good cell compatibility of the coating can be expected in vivo. A rabbit distal femur condyle model was used for in vivo evaluation of the antibacterial efficacy of the tobramycin-loaded coating, and this pilot study showed that the release of tobramycin was sufficient to locally eliminate very large amounts of bacteria in vivo (inoculation dose 104–105 CFU S. aureus/test site).

  • 329.
    Janson, Oscar
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Unosson, Erik
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Effects on organic degradation in the TiO2/H2O2/UV-Vis system2015Inngår i: European Cells and Materials, ISSN 1473-2262, E-ISSN 1473-2262, Vol. 29, s. 20-Artikkel i tidsskrift (Fagfellevurdert)
  • 330.
    Janson, Oscar
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Unosson, Erik
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Effects on organic degradation in the TiO2/H2O2/UV-Vis system2015Inngår i: 8th Annual meeting of the Scandinavian Society for Biomaterials Proceeding, 2015Konferansepaper (Fagfellevurdert)
  • 331.
    Janson, Oscar
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Unosson, Erik
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Organic degradation potential of a TiO2/H2O2/UV-Vis system for dental applications2017Inngår i: Journal of Dentistry, ISSN 0300-5712, E-ISSN 1879-176X, Vol. 67, s. 53-57Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Objectives

    The combination of TiO2 and H2O2 under light activation constitutes a promising method for disinfection of dental prosthetics and implants, due to production of reactive oxygen species (ROS). The aim of this work was to investigate the organic degradation ability of TiO2 particles in combination with H2O2 and under light activation utilizing the organic dye rhodamine B (RhB).

    Methods

    Five different types of TiO2 particles, consisting of anatase, rutile, or a mixture of these crystalline phases, were combined with H2O2 and RhB, and subsequently exposed to UV (365 nm) or visible (405 nm) light at an irradiance of 2.1 mW/cm2.

    Results

    It was found that rutile in combination with low concentrations of H2O2 (1.0–3.5 mM) resulted in a degradation of RhB of 96% and 77% after 10 min exposure to 365 nm and 405 nm light, respectively, which was the highest degradation of all test groups. Control measurements performed without light irradiation or irradiation at 470 nm, or without TiO2 particles resulted in little or no degradation of RhB.

    Conclusions

    Low H2O2 concentrations (1.0 mM–3.5 mM) and visible light (405 nm) used in combination with rutile TiO2 particles showed the highest RhB degradation capacity.

    Clinical significance

    A combination of TiO2 particles and H2O2 exposed to low energy UV or high energy visible light has an organic degradation capability that could be utilized in applications to kill or inactivate bacteria on medical devices such as dental implants for treatment against, e.g., peri-implantitis.

  • 332. Johansson, Christer
    et al.
    Gómez de La Torre, Teresa Zardán
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Sensitive magnetic biodetection using magnetic multi-core nanoparticles and RCA coils2016Inngår i: 11th International Conference on the Scientific and Clinical Applications of Magnetic Carriers, 2016Konferansepaper (Fagfellevurdert)
  • 333. Johansson, Christer
    et al.
    Prieto Astalan, Andrea
    Ahrentorp, Fredrik
    Jonasson, C.
    Blomgren, Jakob
    Zárdan Gómez de la Torre, Teresa
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömberg, Mattias
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Svedlindh, Peter
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Fasta tillståndets fysik.
    Magnetic Properties of Magnetic Multi-Core particles2012Konferansepaper (Fagfellevurdert)
  • 334.
    Johansson, Malin B
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi, Materialteori. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Fasta tillståndets fysik. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - Ångström, Fysikalisk kemi.
    Philippe, Bertrand
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - Ångström, Strukturkemi. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi, Molekyl- och kondenserade materiens fysik.
    Banerjee, Amitava
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi, Materialteori.
    Phuyal, Dibya
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi, Molekyl- och kondenserade materiens fysik.
    Chakraborty, Sudip
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi, Materialteori.
    Cameau, Mathis
    Zhu, Huimin
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - Ångström, Fysikalisk kemi.
    Ahuja, Rajeev
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Fasta tillståndets fysik. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi, Materialteori. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi, Teoretisk fysik. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi, Molekyl- och kondenserade materiens fysik.
    Boschloo, Gerrit
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - Ångström, Fysikalisk kemi.
    Rensmo, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Fysiska sektionen, Institutionen för fysik och astronomi, Molekyl- och kondenserade materiens fysik.
    Johansson, Erik M. J.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - Ångström, Fysikalisk kemi.
    Cesium bismuth iodide, CsxBiyIz, solar cell compounds from systematic molar ratio variationManuskript (preprint) (Annet vitenskapelig)
  • 335.
    Johnson, William B.
    et al.
    W. L. Gore & Associates.
    Worrell, Wayne L.
    University of Pennsylvania.
    Niklasson, Gunnar A
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Fasta tillståndets fysik.
    Malmgren, Sara
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - Ångström, Strukturkemi. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Fasta tillståndets fysik.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Sundaram, S K
    Alfred University.
    Solid-State Devices: Impedance Response of Electrochromic Materials and Devices2018Inngår i: IMPEDANCE SPECTROSCOPY: Theory, Experiment, and Applications / [ed] Evgenij Barsoukov and J. Ross Macdonald, Hoboken,: John Wiley & Sons, 2018, 3rd, s. 247-291Kapittel i bok, del av antologi (Fagfellevurdert)
  • 336.
    Jonsson, A K
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Fasta tillståndets fysik. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material. Fasta tillståndets fysik.
    Larsson, A-L
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Fasta tillståndets fysik. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material. Fasta tillståndets fysik.
    Niklasson, G A
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Fasta tillståndets fysik. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material. Fasta tillståndets fysik.
    Strömme, M
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Fasta tillståndets fysik. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material. Nanoteknologi och funktionella material.
    H+ Conduction Parameters in Solid-State Electrochromic Devices Obtained by the Isothermal2005Inngår i: J. Electrochem. Soc., Vol. 152, s. A377-A379Artikkel i tidsskrift (Fagfellevurdert)
  • 337. Jonsson, A. K.
    et al.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Niklasson, G. A.
    Li intercalation in zirconium dioxide films2000Inngår i: Diffusion and Defect Data. Pt A Defect and Diffusion Forum, Vol. 177, s. 51-58Artikkel i tidsskrift (Fagfellevurdert)
  • 338.
    Jorner, Kjell
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - Ångström, Molekylär biomimetik.
    Dreos, Ambra
    Chalmers, Dept Chem & Chem Engn, Kemigarden 4, SE-41296 Gothenburg, Sweden..
    Emanuelsson, Rikard
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    El Bakouri, Ouissam
    Univ Girona, Dept Quim, IQCC, Campus Montilivi, Girona 17003, Spain..
    Fernández Galván, Ignacio
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - Ångström, Teoretisk kemi. Uppsala Univ, UC3, Box 523, SE-75120 Uppsala, Sweden..
    Borjesson, Karl
    Chalmers, Dept Chem & Chem Engn, Kemigarden 4, SE-41296 Gothenburg, Sweden.;Univ Gothenburg, Dept Chem & Mol Biol, Kemigarden 4, SE-41296 Gothenburg, Sweden..
    Feixas, Ferran
    Univ Girona, Dept Quim, IQCC, Campus Montilivi, Girona 17003, Spain..
    Lindh, Roland
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - Ångström, Teoretisk kemi. Uppsala Univ, UC3, Box 523, SE-75120 Uppsala, Sweden..
    Zietz, Burkhard
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - Ångström, Fysikalisk kemi.
    Moth-Poulsen, Kasper
    Chalmers, Dept Chem & Chem Engn, Kemigarden 4, SE-41296 Gothenburg, Sweden..
    Ottosson, Henrik
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - Ångström, Molekylär biomimetik. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Kemiska sektionen, Institutionen för kemi - BMC.
    Unraveling factors leading to efficient norbornadiene-quadricyclane molecular solar-thermal energy storage systems2017Inngår i: Journal of Materials Chemistry A, ISSN 2050-7488, Vol. 5, nr 24, s. 12369-12378Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Developing norbornadiene-quadricyclane (NBD-QC) systems for molecular solar-thermal (MOST) energy storage is often a process of trial and error. By studying a series of norbornadienes (NBD-R-2) doubly substituted at the C7-position with R = H, Me, and iPr, we untangle the interrelated factors affecting MOST performance through a combination of experiment and theory. Increasing the steric bulk along the NBD-R-2 series gave higher quantum yields, slightly red-shifted absorptions, and longer thermal lifetimes of the energy-rich QC isomer. However, these advantages are counterbalanced by lower energy storage capacities, and overall R = Me appears most promising for short-term MOST applications. Computationally we find that it is the destabilization of the NBD isomer over the QC isomer with increasing steric bulk that is responsible for most of the observed trends and we can also predict the relative quantum yields by characterizing the S-1/S-0 conical intersections. The significantly increased thermal half-life of NBD-iPr(2) is caused by a higher activation entropy, highlighting a novel strategy to improve thermal half-lives of MOST compounds and other photo-switchable molecules without affecting their electronic properties. The potential of the NBD-R-2 compounds in devices is also explored, demonstrating a solar energy storage efficiency of up to 0.2%. Finally, we show how the insights gained in this study can be used to identify strategies to improve already existing NBD-QC systems.

  • 339.
    Jämstorp, Erik
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Bodin, Aase
    Gatenholm, Paul
    Jeppsson, Anders
    Strømme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Release of antithrombotic drugs from alginate gel beads2010Inngår i: Current drug delivery, ISSN 1875-5704, Vol. 7, nr 4, s. 297-302Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    The aim of the present work was to evaluate alginate hydrogels in the form of spherical beads as carrier for antithrombotic drugs for future use in artificial grafts. The ionotropic gelation technique was employed to prepare beads from the L. hyperborea stipe of alginate with two different alginate concentrations and two different guluronic to manuronic acid ratios. The beads were loaded, via soaking, with three different types of low molecular weight model molecules representing drugs with antithrombotic action and their release characteristics were subsequently evaluated. The entire release process of the negatively charged model drugs under study (Salicylic acid and Hirudin), was found to be governed by diffusion, while additional electrostatic interactions between drug molecule and alginate matrix was indicated to influence the release rate of the analyzed positively charged drug molecule (Dipyridamole). It was found that the alginate hydrogel matrix imposed a decrease of the drug diffusion rate on the molecules under study as compared to the corresponding diffusion rates in water. All diffusion coefficients decreased slightly with increasing concentration of alginate and with increasing guluronic to manuronic acid ratio. The results show on the potential use of alginate gel beads when developing vehicles for release of low molecular weight antithrombotic drugs.

  • 340.
    Jämstorp, Erik
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Forsgren, Johan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Bredenberg, Susanne
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Mechanically strong geopolymers offer new possibilities in treatment of chronic pain2010Inngår i: Journal of Controlled Release, ISSN 0168-3659, E-ISSN 1873-4995, Vol. 146, nr 3, s. 370-377Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    We propose that a clay derived class of materials, known as geopolymers, may solve the problem of finding materials for controlled release with the right combination of properties necessary for a safe and sustained oral delivery of highly potent opioids. We show that the opioid Fentanyl, and its structurally similar sedative Zolpidem, can be embedded into metakaolin based geopolymer pellets to provide prolonged release dosage forms with mechanical strengths of the same order of magnitude as that of human teeth. The results presented in the current work may open up new opportunities for future development of drug delivery for high potency drugs employing high-strength and variable-pore-structure geopolymers and materials alike.

  • 341.
    Jämstorp, Erik
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Nyström, Gustav
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strømme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Sjödin, Martin
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    On the self-discharge and degradation of polypyrrole electrodes for energy storage2011Inngår i: MRS Spring conference, San Francisco, 2011Konferansepaper (Fagfellevurdert)
  • 342.
    Jämstorp, Erik
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strømme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Bredenberg, Susanne
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Influence of drug distribution and solubility on release from geopolymer pellets: A finite element method study2012Inngår i: Journal of Pharmaceutical Sciences, ISSN 0022-3549, E-ISSN 1520-6017, Vol. 101, nr 5, s. 1803-1810Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    This study investigates the influence of drug solubility and distribution on its release from inert geopolymer pellets of three different sizes (1.5 × 1.5, 3 × 6, and 6 × 6 mm), having the same geopolymer composition and containing highly potent opioid fentanyl, sumatriptan, theophylline, or saccharin. Scanning electron microscopy, nitrogen sorption, drug solubility, permeation, and release experiments were performed, and estimates of the drug diffusion coefficients and solubilities in the geopolymer matrix were derived with the aid of finite element method (FEM). FEM was further employed to investigate the effect of a nonuniform drug distribution on the drug release profile. When inspecting the release profiles for each drug, it was observed that their solubilities in the geopolymer matrix imposed a much greater influence on the drug release rate than their diffusion coefficients. Concentrating the initial drug load in FEM into nonuniformly distributed drug regions inside the matrix created drug release profiles that more closely resembled experimental data than an FEM-simulated uniform drug distribution did. The presented FEM simulations and visualization of drug release from geopolymers under varying initial and dynamic conditions should open up for more systematic studies of additional factors that influence the drug release profile from porous delivery vehicles.

  • 343.
    Jämstorp, Erik
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strømme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Frenning, Göran
    Uppsala universitet, Medicinska och farmaceutiska vetenskapsområdet, Farmaceutiska fakulteten, Institutionen för farmaci.
    Modeling structure-function relationships for diffusive drug transport in inert porous geopolymer matrices2011Inngår i: Journal of Pharmaceutical Sciences, ISSN 0022-3549, E-ISSN 1520-6017, Vol. 100, nr 10, s. 4338-4348Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    A unique structure-function relationship investigation of mechanically strong geopolymer drug delivery vehicles for sustained release of potent substances is presented. The effect of in-synthesis water content on geopolymer pore structure and diffusive drug transport is investigated. Scanning electron microscopy, N(2) gas adsorption, mercury intrusion porosimetry, compression strength test, drug permeation, and release experiments are performed. Effective diffusion coefficients are measured and compared with corresponding theoretical values as derived from pore size distribution and connectivity via pore-network modeling. By solely varying the in-synthesis water content, mesoporous and mechanically strong geopolymers with porosities of 8%-45% are obtained. Effective diffusion coefficients of the model drugs Saccharin and Zolpidem are observed to span two orders of magnitude (∼1.6-120 × 10(-8) cm(2) /s), comparing very well to theoretical estimations. The ability to predict drug permeation and release from geopolymers, and materials alike, allows future formulations to be tailored on a structural and chemical level for specific applications such as controlled drug delivery of highly potent substances.

  • 344.
    Jämstorp, Erik
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Yarra, Tejaswi
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Cai, Bing
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Engqvist, Håkan
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Bredenberg, Susanne
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Tillämpad materialvetenskap.
    Strømme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Polymer excipients enable sustained drug release in low pH from mechanically strong inorganic geopolymers2012Inngår i: Results in Pharma Sciences, ISSN 2211-2863, Vol. 2, s. 23-28Artikkel i tidsskrift (Fagfellevurdert)
  • 345.
    Jönsson, Mats
    et al.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Elektronik. Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Welch, Ken
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Hamp, Sven
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Bacteria counting with impedance spectroscopy in a micro probe station2006Inngår i: Journal of physical chemistry B, ISSN 1520-6106, Vol. 110, nr 20, s. 10165-10169Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    A method to quantify the density of viable biological cells in suspensions is presented. The method is implemented by low-frequency impedance spectroscopy and based on the finding that immobilized ions are released to move freely in the surrounding suspension when viable Escherichia coli cells are killed by a heat shock. The presented results show that an amount of ions corresponding to 2 × 108 unit charges are released per viable bacterium killed. A micro probe station with coplanar Ti electrodes was electrically characterized and used as a measuring unit for the impedance spectroscopy recordings. This unit is compatible with common microfabrication techniques and should enable the presented method to be employed using a flow-cell device for viable bacteria counting in miniaturized on-line monitoring systems.

  • 346.
    Kaden, Heike
    et al.
    Karlsruhe Institute of Technology.
    Königer, Franz
    Karlsruhe Institute of Technology.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Niklasson, Gunnar A.
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Fasta tillståndets fysik.
    Emmerich, Katja
    Karlsruhe Institute of Technology.
    Low-frequency dielectric properties of three bentonites at different adsorbed water states2013Inngår i: Journal of Colloid and Interface Science, ISSN 0021-9797, E-ISSN 1095-7103, Vol. 411, s. 16-26Artikkel i tidsskrift (Fagfellevurdert)
    Abstract [en]

    Three bentonites of varying smectite content were investigated by dielectric spectroscopy in the frequency range 10(-4) to 10(6)Hz after storage at well-defined humidities. The identification of relaxation processes from complex permittivity measurements was difficult, since conductivity effects were superimposed on the underlying relaxations. Relaxation peaks revealed by the dissipation factor indicated the occurrence of interfacial processes between 10(2) and 10(6) Hz. The intensity of the polarization of the electrochemical double-layer at the clay-water interface was promoted by increasing water content and was shifted to higher frequencies the higher the water content in the bentonites. Below ∼1Hz, electrode polarization (EP) was shown to be a participating process with capacitance values ranging from 0.6(*)10(-3) to 7.3(*)10(-3)F due to the accumulated charges. An equivalent circuit model was introduced that successfully described the low-frequency dielectric behavior of bentonites at low moisture levels. An included series R-CPE connection was used to describe the double-layer relaxation. At water contents up to 17%, the bulk resistivity was mainly influenced by smectite content and cation exchange capacity, whereas at water contents of ⩾19%, interlayer occupation and hydration state became more important.

  • 347. Kalabukhov, A
    et al.
    Gómez de La Torre, Teresa Zardán
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Winkler, Dag
    Chalmers.
    FLU-ID- Bioassays for fast and sensitive detection of influenza viruses using ultra-sensitive magnetometry and magnetic nanoparticles2017Inngår i: Programme conference in Medical Bioengineering 2017 / [ed] Stiftelsen för strategisk Forskning, Stockholm: Stiftelsen för strategisk Forskning , 2017Konferansepaper (Fagfellevurdert)
  • 348. Kalabukhov, A.
    et al.
    Jesorka, A.
    Sanz-Velasco, A.
    Winkler, Dag
    Schneiderman, J.
    Blomgren, J
    Johansson, Christer
    Ahlford, Annika
    Nilsson, Mats
    Albert, Jan
    Gómez de La Torre, Teresa Zardán
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Development of nano-magnetic bioassay for detection of pandemic influenza2016Inngår i: Biosensors 2016, 26th Anniversary World Congress on Biosensors 25-27 May 2016 | Swedish Exhibition and Congress Centre, Gothenburg, Sweden, 2016Konferansepaper (Fagfellevurdert)
  • 349. Kalabukhov, A.
    et al.
    Sepehri, S.
    Chukharkin, M
    Kustanovich, K
    Jesorka, Aldo
    Schneiderman, J
    Blomgren, Jacob
    Johansson, Christer
    Nilsson, Mats
    Gómez de La Torre, Teresa Zardán
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Winkler, Dag
    Chalmers.
    Development of ultra-sensitive magnetic sensor technologies for bioassays using magnetic multi-core nanoparticles and RCA coils2017Inngår i: Programme conference in Medical Bioengineering 2017 / [ed] Stiftelsen för Strategisk Forskning, Stockholm: Stiftelsen för Strategisk Forskning , 2017Konferansepaper (Fagfellevurdert)
  • 350. Kalabukhov, A
    et al.
    Winkler, Dag
    Gómez de La Torre, Teresa Zardán
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    Strömme, Maria
    Uppsala universitet, Teknisk-naturvetenskapliga vetenskapsområdet, Tekniska sektionen, Institutionen för teknikvetenskaper, Nanoteknologi och funktionella material.
    FLU-ID:Development of a low-cost and portable nano-diagnostics unit for detection of pandemic influenza2017Inngår i: Programme conference in Medical Bioengineering 2017 / [ed] Stiftelsen för strategisk forskning, Stockholm: Stiftelsen för strategisk forskning , 2017Konferansepaper (Fagfellevurdert)
45678910 301 - 350 of 1137
RefereraExporteraLink til resultatlisten
Permanent link
Referera
Referensformat
  • apa
  • ieee
  • modern-language-association
  • vancouver
  • Annet format
Fler format
Språk
  • de-DE
  • en-GB
  • en-US
  • fi-FI
  • nn-NO
  • nn-NB
  • sv-SE
  • Annet språk
Fler språk
Utmatningsformat
  • html
  • text
  • asciidoc
  • rtf